| University | Singapore University of Social Science (SUSS) |
| Subject | BME355 Genomic Sequence Analysis Assessment |
Question 1
Using the OMIM database information for Type 2 Diabetes Mellitus (T2D)
(https://omim.org/entry/125853), solve the following tasks.
Question 1a
Extract out the genes associated with T2D and use the list as input in the online tool DAVID (Database for Annotation, Visualization and Integrated Discovery).
(5 marks)
Question 1b
Create a functional annotation clustering of the gene list and paste screenshots of the results from GOTERM_BP/CC/MF_DIRECT and KEGG_PATHWAY. Report the clusters having enrichment score above 1.
(5 marks)
Question 1c
Appraise the results obtained and discuss the relevancy of the findings to the gene list.
(5 marks)
Question 2
Using the NCBI database, explore the gene with Gene ID: 79923.
Question 2a State the gene symbol given to this ID and the full official name of the gene.
(2 marks)
Question 2b
Discuss the function of this gene in your own words.
(5 marks)
Question 2c
Determine the mRNA transcripts and protein isoforms of this gene.
(5 marks)
Question 2d
Describe FIVE (5) pathways which the corresponding gene is involved in.
(5 marks)
Question 2e
Identify the conserved domains in the protein isoforms of this gene.
(3 marks)
Buy Custom Answer of This Assessment & Raise Your Grades
Question 3
Demonstrate your understanding in molecular genetics and computational biology by critically evaluating the following statements.
Question 3a
Protein alignments are often more informative than DNA alignments.
(5 marks)
Question 3b
When comparing two sequences, it is necessary to repeat the search using different scoring matrices.
(5 marks)
Question 3c
The statistical significance of a BLAST result can be assessed through S values.
(5 marks)
Question 3d
Position specific iterated BLAST (PSI-Blast) is often less sensitive than a regular Blast search in finding distantly related protein sequences.
(5 marks)
Question 3e
Benchmarking is an important approach to compare different software and determine their accuracy.
(5 marks)
Question 4
With the help of an alignment tool you have learnt, examine the human sequence given below, and furnish answers to the following questions:
>SEQ
MCGATSFLHECTRLILVTTQNAEFLQKGLQVHTCFGVYPHASVWHDCASQK
KGCAVYLHVSVEFNKLIPE
NGFIKFHQVRRVMTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTH
GTLESVNGPKAGSRGLTS
LADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLE
EYKNYLDAANMSMRVRR
HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQ
YFYETKCNPMGYTKEGCRG
IDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Question 4a
Give the name and accession number of the sequence.
(5 marks)
Question 4b
Appraise the function of the corresponding gene.
(5 marks)
Question 4c
Describe FIVE (5) pathways which the genic form is involved in.
(5 marks)
Question 4d
List the Gene Ontology functions and processes.
(5 marks)
Question 5
Using the resulting information from the above-mentioned sequence in Question 4, extract out the sequences from Homo sapiens and organisms such Pan troglodytes, Canis lupus familiaris, Bos Taurus and Mus musculus
Question 5a
Paste the sequences in fasta format.
(5 marks)
Question 5b
Create a multiple sequence alignment using any multiple sequence alignment tool. Paste the alignment and the phylogenetic tree.
(10 marks)
Question 5c
Evaluate the alignment and the phylogenetic tree derived in Question 5b.
Stuck with a lot of homework assignments and feeling stressed ? Take professional academic assistance & Get 100% Plagiarism free papers
Elevate your academic journey with our Best Assignment Help Singapore services tailored for Malaysia students. As you navigate the challenging waters of your BME355 Genomic Sequence Analysis Assessment at SUSS, Singapore, our experts are here to guide you through Final Year Exam Assignments and offer top-notch Online Report Writing Services. With a focus on leveraging OMIM database information for Type 2 Diabetes Mellitus (T2D), we ensure your success in Genomic Sequence Analysis. Pay our experts and seize the opportunity to excel in your course.
Looking for Plagiarism free Answers for your college/ university Assignments.
- COR1100 Writing and Reasoning Assessment 3 , 2026 | SMU
- LOG206 Transport Management and Technology Group-based Assignment 2026 | SUSS
- NCO212 The ‘Smart City’ and Society Pre-Class Quiz Assignment 2026 | SUSS
- CVEN3501 Water Resources Engineering Coursework Brief 2026 | UNSW
- MKTG101 Marketing Coursework Brief 2026 | Singapore Management University
- NCO102 Effective Writing Tutor-Marked Assignment 1, 2026 | SUSS
- SC1101E Making Sense of Society Written Assignment 1 Brief 2026 | NUS
- BUSM2653 People Analytics Assesment 1 Insightful Analytics Report 2026 | SIM
- MLA604 Maritime Operations Assessment Brief 2026 | MLA College
- ICT226 Enterprise Systems and Integrated Business Process End-of-Course Assessment 2026 | SUSS
