| University | Singapore University of Social Science (SUSS) |
| Subject | BME355: Genomic Sequence Analysis |
Question 1
Imagine you have been assigned the task of determining the functional importance of the human ACE2 gene. Investigate and furnish answers to the following questions:
- Provide the full name of the gene and the chromosome it is found on.
- Discuss the function of this gene.
- List the pathways this gene is involved in.
Question 2
Examine the following statements and critically evaluate their accuracy. The answer to each question should not be more than 300 words.
- Protein alignments are often more informative than DNA alignments.
- It is never correct to say that two sequences share a certain percentage of homology.
- When comparing two sequences, it may be necessary to repeat the search using different scoring matrices.
- Position-specific iterated BLAST (PSI-Blast) is often more sensitive than a regular Blast search in finding distantly related protein sequences.
- Benchmarking is an important approach to compare different software and determine their accuracy.
Stuck with a lot of homework assignments and feeling stressed ? Take professional academic assistance & Get 100% Plagiarism free papers
Question 3
Analyze the Conserved Domain Database (CDD) identifier cd03683 to solve the following questions:
- Determine the protein family the CDD identifier represents. What are the functions of the protein family?
- Identify conserved features or sites.
- Obtain FIVE (5) representative protein sequences in FASTA format and conduct a multiple sequence alignment. (Paste the screenshot of the MSA generated).
- Evaluate the multiple sequence alignment generated.
Question 4
Analyze the given sequence using bioinformatics tools and answer the following questions:
>testseq
MALFVRLLALALALALGPAATLAGPAKSPYQLVLQHSRLR
GRQHGPNVCAVQKVIGTNRKYFTNCKQWYQRKICGKSTVI
SYECCPGYEKVPGEKGCPAALPLSNLYETLGVVGSTTTQLY
TDRTEKLRPEMEGPGSFTIFAPSNEAWASLPAEVLDSLVSN
VNIELLNALRYHMVGRRVLTDELKHGMTLTSMYQNSNIQIH
HYPNGIVTVNCARLLKADHHATNGVVHLIDKVISTITNNIQQ
IIEIEDTFETLRAAVAASGLNTMLEGNGQYTLLAPTNEAFEK
IPSETLNRILGDPEALRDLLNNHILKSAMCAEAIVAGLSVET
LEGTTLEVGCSGDMLTINGKAIISNKDILATNGVIHYIDELLI
PDSAKTLFELAAESDVSTAIDLFRQAGLGNHLSGSERLTLL
- Solve the identity of the sequence and the organism it belongs to. Using screenshots list out the steps used to determine its identity.
- Determine the function of the sequence and the conserved domains present in it.
- List out the Gene Ontology processes and the pathways its corresponding gene is involved in.
Question 5
Answer the following questions in your own words. The answer to each question should not be more than 300 words.
- Evaluate the difference between Local and Global alignments.
- Describe the BLAST algorithm.
- Evaluate how the statistical significance of a BLAST search result is assessed through E-values.
- Demonstrate the practical applications of multiple sequence alignments.
Our experienced assignment writers are experts in writing complex (BME355) genomic sequence analysis assignments for SUSS university students as per their teacher's specifications. We not only assist you but also provide you a way to learn a subject. Contact us to get an online assignment help instantly.
Looking for Plagiarism free Answers for your college/ university Assignments.
- NCO212 The ‘Smart City’ and Society Pre-Class Quiz Assignment 2026 | SUSS
- CVEN3501 Water Resources Engineering Coursework Brief 2026 | UNSW
- MKTG101 Marketing Coursework Brief 2026 | Singapore Management University
- NCO102 Effective Writing Tutor-Marked Assignment 1, 2026 | SUSS
- SC1101E Making Sense of Society Written Assignment 1 Brief 2026 | NUS
- BUSM2653 People Analytics Assesment 1 Insightful Analytics Report 2026 | SIM
- MLA604 Maritime Operations Assessment Brief 2026 | MLA College
- ICT226 Enterprise Systems and Integrated Business Process End-of-Course Assessment 2026 | SUSS
- OMGT2229 Strategic Supply Chain Assignment 3, 2026 | RMIT University
- NCO103 Listen and Be Heard: Effective Communication through Storytelling TMA 02, 2026 | SUSS
