| University | Singapore University of Social Science (SUSS) |
| Subject | BME355: Genomic Sequence Analysis |
Question 1
Imagine you have been assigned the task of determining the functional importance of the human ACE2 gene. Investigate and furnish answers to the following questions:
- Provide the full name of the gene and the chromosome it is found on.
- Discuss the function of this gene.
- List the pathways this gene is involved in.
Question 2
Examine the following statements and critically evaluate their accuracy. The answer to each question should not be more than 300 words.
- Protein alignments are often more informative than DNA alignments.
- It is never correct to say that two sequences share a certain percentage of homology.
- When comparing two sequences, it may be necessary to repeat the search using different scoring matrices.
- Position-specific iterated BLAST (PSI-Blast) is often more sensitive than a regular Blast search in finding distantly related protein sequences.
- Benchmarking is an important approach to compare different software and determine their accuracy.
Stuck with a lot of homework assignments and feeling stressed ? Take professional academic assistance & Get 100% Plagiarism free papers
Question 3
Analyze the Conserved Domain Database (CDD) identifier cd03683 to solve the following questions:
- Determine the protein family the CDD identifier represents. What are the functions of the protein family?
- Identify conserved features or sites.
- Obtain FIVE (5) representative protein sequences in FASTA format and conduct a multiple sequence alignment. (Paste the screenshot of the MSA generated).
- Evaluate the multiple sequence alignment generated.
Question 4
Analyze the given sequence using bioinformatics tools and answer the following questions:
>testseq
MALFVRLLALALALALGPAATLAGPAKSPYQLVLQHSRLR
GRQHGPNVCAVQKVIGTNRKYFTNCKQWYQRKICGKSTVI
SYECCPGYEKVPGEKGCPAALPLSNLYETLGVVGSTTTQLY
TDRTEKLRPEMEGPGSFTIFAPSNEAWASLPAEVLDSLVSN
VNIELLNALRYHMVGRRVLTDELKHGMTLTSMYQNSNIQIH
HYPNGIVTVNCARLLKADHHATNGVVHLIDKVISTITNNIQQ
IIEIEDTFETLRAAVAASGLNTMLEGNGQYTLLAPTNEAFEK
IPSETLNRILGDPEALRDLLNNHILKSAMCAEAIVAGLSVET
LEGTTLEVGCSGDMLTINGKAIISNKDILATNGVIHYIDELLI
PDSAKTLFELAAESDVSTAIDLFRQAGLGNHLSGSERLTLL
- Solve the identity of the sequence and the organism it belongs to. Using screenshots list out the steps used to determine its identity.
- Determine the function of the sequence and the conserved domains present in it.
- List out the Gene Ontology processes and the pathways its corresponding gene is involved in.
Question 5
Answer the following questions in your own words. The answer to each question should not be more than 300 words.
- Evaluate the difference between Local and Global alignments.
- Describe the BLAST algorithm.
- Evaluate how the statistical significance of a BLAST search result is assessed through E-values.
- Demonstrate the practical applications of multiple sequence alignments.
Our experienced assignment writers are experts in writing complex (BME355) genomic sequence analysis assignments for SUSS university students as per their teacher's specifications. We not only assist you but also provide you a way to learn a subject. Contact us to get an online assignment help instantly.
Looking for Plagiarism free Answers for your college/ university Assignments.
- HS6433 Health Promotion and Counselling Assignment 2026 | NYP
- BCEC002 Business Economics Individual Assignment Brief 2026 | Temasek Polytechnic
- PSBA300CA / PSBA300CW Academic Writing 3: Writing Skills for Dissert and Res Prj (Engineering) PT Assignment
- MGT557 Leading the Company of the Future End-of-Course Assessment – January Semester 2026
- PSS304 Psychological Perspective to Public Safety Assignment Questions 2026 | SUSS
- PSS309 Cybercrime Tutor-Marked Assignment 01, Jan 2026 Presentation | SUSS
- CMM315 Peacebuilding and Security Tutor-Marked Assignment – 01, January 2026 Presentation
- S2470C Behaviour Change Coursework Asessment 2026 | Republic Polytechnic
- S3470C Nutrition Care Process Coursework Assessment 2026 | Republic Polytechnic
- PSY371 Performance Psychology Tutor-Marked Assignment – 01, January 2026 Presentation
